DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and EHD3

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_010321.1 Gene:EHD3 / 851606 SGDID:S000002443 Length:500 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:59/193 - (30%)
Similarity:101/193 - (52%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSE--KAFAAGADIKEMV----GNT 112
            ||||||||.||||...:.:.:...|.:::|..|.:.::|..|.  ::|.||.|:..:.    ...
Yeast    49 VITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKE 113

  Fly   113 YSQCIQGNFLNDWT---EVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGT 174
            :::.|: .|.::::   ::|...|||:..::|..:|||..|::......|.:..|:..||:.:|.
Yeast   114 FAKSIK-FFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGF 177

  Fly   175 IPGAGGTQRLTRVV-----GKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGE 232
            .|..|.|..|.|:|     ....|:.:||||.::...:|..|||||..|.::.|.....:|||
Yeast   178 FPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 59/193 (31%)
EHD3NP_010321.1 ECH_2 48..386 CDD:406503 59/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.