DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ECHID

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_176255.2 Gene:ECHID / 842350 AraportID:AT1G60550 Length:337 Species:Arabidopsis thaliana


Alignment Length:280 Identity:95/280 - (33%)
Similarity:137/280 - (48%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WEYIKTEVAGEGKN---------------VGVITLNRPKALNALCNGLMKELSTALQQFSKDKTI 87
            |:  ||:..|||.|               :..||:|||:..||.....:|||..|......|.::
plant    60 WK--KTDFFGEGDNKEFVDIIYEKALDEGIAKITINRPERRNAFRPQTVKELMRAFNDARDDSSV 122

  Fly    88 SAIVLTG-SEKAFAAGADIKEMVGNTY---SQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGC 148
            ..|:||| ..|||.:|.|......:.|   :...:.|.|:...::.|..||:||.|.|||:|||.
plant   123 GVIILTGKGTKAFCSGGDQALRTQDGYADPNDVGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGH 187

  Fly   149 ELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGL 213
            .|.|:||:..|.|.|.|||....:|:.....|:..::|:||..||.||........|.||||:||
plant   188 ILHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVGPKKAREMWFMTRFYTASEAEKMGL 252

  Fly   214 ASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYE--TTLQEGLKFERRTFHAT---FS 273
            .:.|||.:.|..|.||...:|..:|...:::.|.|:|...:  ..|| ||..:     ||   :.
plant   253 INTVVPLEDLEKETVKWCREILRNSPTAIRVLKAALNAVDDGHAGLQ-GLGGD-----ATLLFYG 311

  Fly   274 TADRKEGMTAFAEKRPAKFT 293
            |.:..||.||:..:||..|:
plant   312 TEEATEGRTAYMHRRPPDFS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 95/280 (34%)
ECHIDNP_176255.2 PLN02921 7..337 CDD:178509 95/280 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.