DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and AT4G16800

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_193413.2 Gene:AT4G16800 / 827386 AraportID:AT4G16800 Length:301 Species:Arabidopsis thaliana


Alignment Length:261 Identity:90/261 - (34%)
Similarity:142/261 - (54%) Gaps:8/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EYIK-TEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTG-SEKAFAA 101
            |::| ..::|....:..:.|:||...||:...::|.|..|.:...:|.:...:::.. ....|.|
plant    41 EFVKLNRLSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCA 105

  Fly   102 GADIKEMVGNTYSQCIQGNFLND----WTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDK 162
            |||:||.  .|.|......::|.    ::.:.....|.|||:.|.|||||.|:|:.||:...|:.
plant   106 GADLKER--RTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGEN 168

  Fly   163 AKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEA 227
            |.||.||..|..||||||||||:|:||:|.:.|:..||..|.|.||...||.:..|.|.:...:|
plant   169 AVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAHEKA 233

  Fly   228 VKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPAKF 292
            :::.::|.....|.:::.|:|::...||.:..||:.|...:....:|.||.||:.||||||...:
plant   234 IEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRKPLY 298

  Fly   293 T 293
            |
plant   299 T 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 90/261 (34%)
AT4G16800NP_193413.2 PLN02600 51..300 CDD:178210 87/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.