DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and hibch

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001014338.1 Gene:hibch / 798364 ZFINID:ZDB-GENE-050327-29 Length:382 Species:Danio rerio


Alignment Length:314 Identity:86/314 - (27%)
Similarity:145/314 - (46%) Gaps:59/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLM 71
            ||.|..:  |::..|..::.....||...:...:.|.     || .||||||||||||||...::
Zfish     5 IFTSAQR--LRSVCRLQRIHGHMMSSKAGSEVLFEKV-----GK-AGVITLNRPKALNALTLNMI 61

  Fly    72 KELSTALQQFSKDKTISAIVLTGS-EKAFAAGADIKEM-----VGNTYSQCI--QGNFLNDWTEV 128
            :.:...|:::.||.....:::.|: ||||.||.||:.:     .||..||..  :...||:  .:
Zfish    62 RHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIAEAGKAGNLLSQVFFREEYILNN--TI 124

  Fly   129 ARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKA 193
            ...|||.:|.:||..:|||..|::......|.:|..|..||..:|..|..||...|.|:.|| ..
Zfish   125 GTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPDVGGGYFLPRLQGK-LG 188

  Fly   194 MEMCLTGNMIGAQEAEKLGLASKVVPADQL--------------LGEAVKLGEKIGTHSNL---- 240
            :.:.|||..:..::.:::|:|:..|.::::              :.:..:|.:.....|:|    
Zfish   189 LFLALTGFRLKGRDVQRVGVATHFVQSEKIESLEKDLVDLKSPSISDVAQLLDSYQEQSHLDAEK 253

  Fly   241 --IVQLCKEAVNTAYET----TLQEGLKFERRTFHATFSTADRKEGMTAFAEKR 288
              ::|...||::..:..    .:.|.||               |:| :|||.|:
Zfish   254 PFVLQEQTEAIDRLFSAGSVEEIVENLK---------------KDG-SAFALKQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 79/284 (28%)
hibchNP_001014338.1 PRK05617 30..374 CDD:235533 79/287 (28%)
ECH_2 43..371 CDD:292731 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.