DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Cdyl2

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_083717.1 Gene:Cdyl2 / 75796 MGIID:1923046 Length:503 Species:Mus musculus


Alignment Length:243 Identity:59/243 - (24%)
Similarity:109/243 - (44%) Gaps:17/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVL 92
            |:|.....:|..:....|..|.....::..::....|||...:|||:..||...:.|.: ..::|
Mouse   234 RYSVRQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDS-KLLLL 297

  Fly    93 TGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDWTEVART-----------QKPIIAAVNGYALGG 146
            :.....|.:|.|...::|.     :..:...:.|.:|..           :|||:.|:||.|||.
Mouse   298 SAVGSVFCSGLDYSYLIGR-----LSSDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGL 357

  Fly   147 GCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKL 211
            |..:..:|||::|.:||.|..|...:...|....:....:::|.:.|.||...|..:.||||...
Mouse   358 GASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSR 422

  Fly   212 GLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQE 259
            ||.|:|........|.:...:::.:.|.::::..|..|.:..::.|:|
Mouse   423 GLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 57/234 (24%)
Cdyl2NP_083717.1 CHROMO 7..55 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..177
crotonase-like 249..445 CDD:119339 51/201 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.