DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Eci3

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_081223.1 Gene:Eci3 / 69123 MGIID:1916373 Length:317 Species:Mus musculus


Alignment Length:284 Identity:74/284 - (26%)
Similarity:128/284 - (45%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VATRFSSSSTNNNWEYIKTEVAGEGKNVGV--------ITLNRPKALNALCNGLMKELSTALQQF 81
            |::..|||...:..:....|.|.|.|::.|        ||.|||...||:...:..::..||:..
Mouse    37 VSSLSSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKNAISFQMYLDIMHALKNA 101

  Fly    82 SKDKTISAIVLTGSEKAFAAGADIKEMVGN--------TYSQCIQGNFLNDWTEVARTQKPIIAA 138
            |.|.:: ..|.||:...:::|.|:|.::.:        ..|..|...|:|.:.:.   .||::|.
Mouse   102 STDNSV-ITVFTGTGDYYSSGNDLKNLINDAGEIQDVVATSTKILREFVNCFIDF---PKPLVAV 162

  Fly   139 VNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMI 203
            |||.|:|....:..:.|.::|.|:|.|..|...|..||.|..|....:::|.:||.||.|.|..:
Mouse   163 VNGPAVGIAVTILALFDAVFASDRATFHTPFSQLSQIPEACSTYMFPKIMGPTKAAEMLLFGKKL 227

  Fly   204 GAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNL---IVQLCKEAVNTAYETTLQEGLKFER 265
            .|:||...||.::|.|....   ..::..::.|:|.|   ::::.||.:.           |.|:
Mouse   228 TAREAWAQGLVTEVFPESTF---ETEVWTRLKTYSKLSPNVMRISKELIR-----------KHEK 278

  Fly   266 RTFHATFSTADRKEGMTAFAEKRP 289
            :..:..     ..|...|..|:.|
Mouse   279 QKLYTV-----NAEECAAALERMP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 70/272 (26%)
Eci3NP_081223.1 ACBP <2..37 CDD:376410 74/284 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 5/19 (26%)
crotonase-like 64..256 CDD:119339 55/198 (28%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 120..124 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 315..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.