DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and cdyl

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:275 Identity:69/275 - (25%)
Similarity:128/275 - (46%) Gaps:15/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVL 92
            |||...|.:.:.|....|..:.....::...:....|:|...:|||:.:|:...:.|.: ..::|
Zfish   312 RFSVRQTESAYRYRDIVVKKQDGFTHILFSTKTSENNSLNPDVMKEVQSAMATAAADDS-KLVLL 375

  Fly    93 TGSEKAFAAGAD----IKEMVGNTYSQCIQ-----GNFLNDWTEVARTQKPIIAAVNGYALGGGC 148
            :|....|..|.|    |:.:..:...:.|:     ..|:|.:.:.   :|||||||||.|:|.|.
Zfish   376 SGVGSVFCFGLDFIYFIRRLTDDRKKESIKMAETIRTFVNTFIQF---KKPIIAAVNGPAIGLGA 437

  Fly   149 ELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGL 213
            .:..:||:|:|.:||.|..|....|..|.|..:.....::|.:.|.||.|:|..:.||||...||
Zfish   438 SILPLCDVIWANEKAWFQTPYTTFGQTPDACSSVTFPLIMGVASANEMLLSGRKLTAQEACAKGL 502

  Fly   214 ASKVV-PADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADR 277
            .|:|: |........|::.|.:..:| ::::..|..|.......|::..:.|.......:.::..
Zfish   503 VSQVLWPGTFTQEVMVRIKELVSCNS-VVLRESKALVRNINRAALEQANERECEALKRVWGSSQG 566

  Fly   278 KEGMTAFAEKRPAKF 292
            .:.:..:.:|:..:|
Zfish   567 MDSILKYLQKKIDEF 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 65/266 (24%)
cdylXP_696879.5 CHROMO 8..61 CDD:214605
crotonase-like 327..523 CDD:119339 56/199 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.