DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ECHDC1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001132982.1 Gene:ECHDC1 / 55862 HGNCID:21489 Length:307 Species:Homo sapiens


Alignment Length:262 Identity:66/262 - (25%)
Similarity:125/262 - (47%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TRFSSSSTNNNW---EYIKT---------EVAGEGKNVGVITLNRPKALNALCNGLMKEL---ST 76
            |..|..||::.:   |..||         ::..|...:|::|||.|..:||....:|.:|   ..
Human    27 TGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVI 91

  Fly    77 ALQQFSKDKTISAIVLTGSEKAFAAGADIK--EMVGNTYSQCIQGNFL-NDWTEVARTQKPIIAA 138
            .|:.:::.|   .:::.|::..|::|:|:.  :.:|..........|: |..|...|.....:|.
Human    92 ELENWTEGK---GLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVAL 153

  Fly   139 VNGYALGGGCELAMMCD--IIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGN 201
            |.|:|||||.|....||  ::....|.:|...|  :|.||..|||.||..::|..:|:::.....
Human   154 VQGWALGGGAEFTTACDFRLMTPESKIRFVHKE--MGIIPSWGGTTRLVEIIGSRQALKVLSGAL 216

  Fly   202 MIGAQEAEKLGLASKVVPAD---QLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKF 263
            .:.::.|..:|:..:|:.:.   :.|.||.:..::.......:::..|::|.:..|..|:|.|:.
Human   217 KLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQN 281

  Fly   264 ER 265
            ||
Human   282 ER 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 62/252 (25%)
ECHDC1NP_001132982.1 crotonase-like 60..251 CDD:119339 51/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.