DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and echdc1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001315065.1 Gene:echdc1 / 553585 ZFINID:ZDB-GENE-050522-370 Length:302 Species:Danio rerio


Alignment Length:241 Identity:60/241 - (24%)
Similarity:103/241 - (42%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGA 103
            |..|.:.:|    :.|:|::.|..:||....:|.||...:.:........|:::.|:...|.:|:
Zfish    50 ELQKLQESG----IAVLTVSNPARMNAFSGCMMLELEQRVNELEIWTEGKAVIVQGAAGNFCSGS 110

  Fly   104 DIKEM--VGNTYSQCIQGNFL-NDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKF 165
            |:..:  :.|.:.......|: |....:.|.....:|.|.|.|||||.||...||.......|..
Zfish   111 DLNAVRAIANPHDGMKMCEFMQNTLARLLRLPLISVALVEGRALGGGAELTTACDFRLMTSDAVI 175

  Fly   166 GQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKL 230
            ......:|.:||.||..||..::|...|:::......:.....:::||..:|:......|:|:..
Zfish   176 QFVHKHMGLVPGWGGAARLVGIIGSRNALKLLSGARKVDPDYGKQMGLVDEVLQCSSGEGKALAH 240

  Fly   231 GEKIGTH--------SNLIVQLCKEAVNTAYETTLQEGLKFERRTF 268
            .|    |        ...::|..|:.|.:..|.:|.|.||.||..|
Zfish   241 AE----HWIAPFIKGPAPVIQAIKKVVVSGRELSLDEALKCERSVF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 60/241 (25%)
echdc1NP_001315065.1 crotonase-like 55..244 CDD:119339 46/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.