DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ECHDC2

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_011540011.1 Gene:ECHDC2 / 55268 HGNCID:23408 Length:318 Species:Homo sapiens


Alignment Length:256 Identity:88/256 - (34%)
Similarity:128/256 - (50%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELS 75
            |..|:|:  ..:|..|...:|.......|.....:||..:.:..|.:|||.|.|||.|..:.||.
Human     3 RVLCLLR--PWRPLRARGCASDGAAGGSEIQVRALAGPDQGITEILMNRPSARNALGNVFVSELL 65

  Fly    76 TALQQFSKDKTISAIVL-TGSEKAFAAGADIKEM-------VGNTYSQCIQGNFLNDWTEVARTQ 132
            ..|.|..:|:.:..::. :|.:..|.||||:||.       || .:.|.::| .:||   :|...
Human    66 ETLAQLREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVG-VFVQRLRG-LMND---IAAFP 125

  Fly   133 KPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMC 197
            .|.|||::|:|||||.|||:.||:..|...|..|..|...|.:|||||||||.|.:|.:.|.|:.
Human   126 APTIAAMDGFALGGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI 190

  Fly   198 LTGNMIGAQEAEKLGLASKVV----PADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYE 254
            .||..:...||..|||.:..|    ..|.....|..|.::|...:.:.|:|.|.|::...|
Human   191 FTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 82/230 (36%)
ECHDC2XP_011540011.1 crotonase-like 38..252 CDD:304874 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.