DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and AUH

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_005252123.1 Gene:AUH / 549 HGNCID:890 Length:349 Species:Homo sapiens


Alignment Length:265 Identity:93/265 - (35%)
Similarity:134/265 - (50%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKA-FAAGADIK 106
            :.:|.:...:.|:.:||....|:|...|:|.||.|:.....||.:..|::...... |.||||:|
Human    90 SSMAADHYRIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLK 154

  Fly   107 EMVGNTYSQCIQGNF-------LNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAK 164
            |....:.|:.  |.|       :||   :|....|.|||::|.|||||.|||:.|||..|...||
Human   155 ERAKMSSSEV--GPFVSKIRAVIND---IANLPVPTIAAIDGLALGGGLELALACDIRVAASSAK 214

  Fly   165 FGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVV----PADQLLG 225
            .|..|..|..|||.||||||.|.:|.|.|.|:..:..::..:||:.:||.|.|:    ..|....
Human   215 MGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYR 279

  Fly   226 EAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRPA 290
            :|:.|..:......:.:::.|.|:|...|..|..||..|...:..|..|.||.||:.||.||||.
Human   280 KALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPP 344

  Fly   291 KFTNE 295
            ::..|
Human   345 RYKGE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 92/262 (35%)
AUHXP_005252123.1 crotonase-like 99..349 CDD:304874 91/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.