DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and hibch

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001016188.1 Gene:hibch / 548942 XenbaseID:XB-GENE-947696 Length:385 Species:Xenopus tropicalis


Alignment Length:207 Identity:63/207 - (30%)
Similarity:98/207 - (47%) Gaps:19/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTG-SEKAFAAGADIKEM--VGNTYS 114
            ||||||||||||||..|:::.:...|..:.:|.....:::.| ..|||.||.||:.:  .|....
 Frog    46 GVITLNRPKALNALNLGMIRLIYPQLGLWEEDPETYLVIIKGVGGKAFCAGGDIRAVTDAGKAGD 110

  Fly   115 QCIQGNFLNDW---TEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIP 176
            :..|..|..::   ..:...:||.:|.::|..:|||..|::......|.:...|..||.|:|..|
 Frog   111 RLAQDFFREEYILNNAIGTYKKPYVALIDGITMGGGVGLSVHGHFRVASENTLFAMPETAIGLFP 175

  Fly   177 GAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKI-GTHSNL 240
            ..||...|.|:.|| ..:.:.|||..:...:.:|.|:|:..|.:           ||| ....:|
 Frog   176 DVGGGYFLPRLPGK-LGLYLALTGFRLKGSDVQKAGIATHFVES-----------EKIPSLEQDL 228

  Fly   241 IVQLCKEAVNTA 252
            :...|....|.|
 Frog   229 VAMKCPSKENVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 63/207 (30%)
hibchNP_001016188.1 ECH_2 45..375 CDD:379770 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.