DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Echdc1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006512860.1 Gene:Echdc1 / 52665 MGIID:1277169 Length:374 Species:Mus musculus


Alignment Length:284 Identity:73/284 - (25%)
Similarity:143/284 - (50%) Gaps:40/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AQCVLQA--AARQPQVATRFSSSSTNNNW--EYIK----------TEVAGEGKNVGVITLNRPKA 62
            |:|:|.:  :.|...:.|..|..:|::.:  |.:|          .::..:...:|::|||.|..
Mouse    77 AKCLLTSSLSVRTKLLQTGVSLYNTSHGFHEEEVKKILEQFPGGSIDLLKKQNGIGILTLNNPNK 141

  Fly    63 LNALCNGLMKEL---STALQQFSKDKTISAIVLTGSEKAFAAGADIKEM-------VGNTYSQCI 117
            :||....:|.:|   ...|:.:::.|   .:::.|::..|.:|:|:..:       .|...|..:
Mouse   142 MNAFSGVMMLQLLERVIELENWTEGK---GLIIHGAKNTFCSGSDLNAVKALSTPESGVALSMFM 203

  Fly   118 QGNFLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKA--KFGQPEIALGTIPGAGG 180
            |    |..|...|.....:|.|.|:|:|||.||...||.....:::  :|...|  :|.:|..||
Mouse   204 Q----NTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHKE--MGIVPSWGG 262

  Fly   181 TQRLTRVVGKSKAMEMCLTGNM-IGAQEAEKLGLASKVV-PADQ--LLGEAVKLGEKIGTHSNLI 241
            |.||..::|..:|::: |:|.: :.::||..:||..:|: |:|:  .|.:|.:..||..:....:
Mouse   263 TSRLVEIIGSRQALKV-LSGTLKLDSKEALNIGLTDEVLQPSDETTALEQAQEWLEKFVSGPPQV 326

  Fly   242 VQLCKEAVNTAYETTLQEGLKFER 265
            ::..|::|.:|.|..::|.|:.||
Mouse   327 IRGLKKSVCSARELYIEEALQNER 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 66/257 (26%)
Echdc1XP_006512860.1 crotonase-like 124..318 CDD:119339 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.