DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and eci2

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001002645.3 Gene:eci2 / 436918 ZFINID:ZDB-GENE-040718-392 Length:392 Species:Danio rerio


Alignment Length:278 Identity:80/278 - (28%)
Similarity:119/278 - (42%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGK-----------NVGVITLNRPKALNALCN 68
            :.|..|||..|  ...||........:..:..|.||           |:..|.||||...||:..
Zfish   102 ISQEEARQQYV--DLISSLVGAEAPAVAAQPTGGGKTFQTLLVSTEDNITTIRLNRPDKKNAITV 164

  Fly    69 GLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQG---NFLNDWTEVAR 130
            .:..||..||:...||.:: ..|:||:...:.:|.|:     |.:::..:|   ....|..|:.|
Zfish   165 EMYNELIEALELAGKDDSV-ITVMTGNGDYYCSGNDL-----NNFTKIPEGGVEKMAKDAGELLR 223

  Fly   131 T--------QKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRV 187
            .        .||:|..:||.|:|....|..:.|::||.:||.|..|...||..|....:....::
Zfish   224 RYVKAYIDFPKPLIGVINGPAVGVSVTLLGLFDVVYATEKATFHTPFSQLGQSPEGCSSYLFPKM 288

  Fly   188 VGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEA---VKLGEKIGTHS-----NLIVQL 244
            :|.:||.|:.|....:.|.:|.:|||.|:|.|......|.   :|...|:..:|     .||..|
Zfish   289 MGAAKASEVLLFNKKLSATQACELGLVSEVFPESSFQSEVWSRLKAYAKLPKNSLALSKQLIRGL 353

  Fly   245 CKE---AVNTAYETTLQE 259
            .||   |||.|....|.|
Zfish   354 EKEKLHAVNDAEVERLTE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 73/256 (29%)
eci2NP_001002645.3 ACBP 39..123 CDD:238248 7/22 (32%)
crotonase-like 140..387 CDD:329030 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.