DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and CG6984

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster


Alignment Length:297 Identity:82/297 - (27%)
Similarity:135/297 - (45%) Gaps:22/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NIAKIFASRAQCVLQAAARQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALC 67
            |..||......||        |...||:|:..::      ..:..|...|..||||.||.||:|.
  Fly     7 NSLKISKYATGCV--------QQVIRFTSNGPSD------LVLVKEHNGVREITLNHPKTLNSLS 57

  Fly    68 NGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQ-CIQGNFLNDWTEVART 131
            ..:|..|..||.:...:..:..:|||...|.::||.::||:..:...| |:.....:...::.|.
  Fly    58 LDMMCALQDALLKDKDNLDLRCVVLTAQGKIWSAGHNLKELHNDPKIQACVFQKLTDVINDIQRL 122

  Fly   132 QKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALG---TIPGAGGTQRLTRVVGKSKA 193
            ..|::..|||||...||:|.:.||::.....:||..|...:|   :.||..    :.|::.:.|:
  Fly   123 PVPVLGKVNGYAAAAGCQLVVSCDMVVCTKNSKFSTPGAGVGVFCSTPGVA----VARIMSRPKS 183

  Fly   194 MEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQ 258
            ..|.:||..:..:||...|:.:|.|||::|..|..::...|...|..::.|.||........:..
  Fly   184 AYMLMTGLPVTGEEAYISGMVTKAVPAEELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMSQA 248

  Fly   259 EGLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE 295
            |.....:......|...|.|||:.:|.||||..:.::
  Fly   249 EAFSAAQEKMCENFQLGDTKEGIASFFEKRPPNWKHQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 73/260 (28%)
CG6984NP_611187.1 crotonase-like 24..283 CDD:304874 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.