DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Echdc1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001007735.1 Gene:Echdc1 / 361465 RGDID:1359654 Length:299 Species:Rattus norvegicus


Alignment Length:230 Identity:62/230 - (26%)
Similarity:119/230 - (51%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VGVITLNRPKALNALCNGLMKEL---STALQQFSKDKTISAIVLTGSEKAFAAGADIKEMV---- 109
            :|::|||....:||....:|.:|   ...|:.:::.|   .:::.|::..|.:|:|:..:.    
  Rat    56 IGILTLNNSNKMNAFSGAMMLQLLERVIELENWTEGK---GLIVHGAKNTFCSGSDLNAVKALST 117

  Fly   110 ---GNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKA--KFGQPE 169
               |...|..:|    |..|...|.....:|.|.|:|:|||.||...||.....:::  :|...|
  Rat   118 PENGVALSMFMQ----NTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHKE 178

  Fly   170 IALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNM-IGAQEAEKLGLASKVV-PADQ--LLGEAVKL 230
              :|.:|..||..||..::|..:|::: |:|.. :.::||.::|||.:|: |:|:  .|.:|.:.
  Rat   179 --MGIVPSWGGASRLVEIIGSRQALKV-LSGTFKLDSKEALRIGLADEVLQPSDEATALEQAQEW 240

  Fly   231 GEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFER 265
            .|:..:....:::..|::|.:..|..|:|.|:.||
  Rat   241 LEQFVSGPAQVIRGLKKSVCSGRELYLEEALQNER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 62/230 (27%)
Echdc1NP_001007735.1 crotonase-like 52..243 CDD:119339 53/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.