DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Cdyl

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:275 Identity:65/275 - (23%)
Similarity:125/275 - (45%) Gaps:15/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVL 92
            |||...|.:.:.|....|..:.....::...:....|:|...:|||:.:||...:.|.: ..::|
  Rat   348 RFSVRQTESAYRYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLL 411

  Fly    93 TGSEKAFAAGADI----------KEMVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGG 147
            :.....|..|.|.          ::......::.|: ||:|.:.:.   :||||.||||.|:|.|
  Rat   412 SAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIR-NFVNTFIQF---KKPIIVAVNGPAIGLG 472

  Fly   148 CELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLG 212
            ..:..:||:::|.:||.|..|....|..|....|....:::|.:.|.||.|:|..:.||||...|
  Rat   473 ASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKG 537

  Fly   213 LASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADR 277
            |.|:|........|.:...:::.:.:.::::..|..|....:..|::..:.|.......:.:|..
  Rat   538 LVSQVFWPGTFTQEVMVRIKELASCNPIVLEESKALVRCNMKMELEQANERECDALKKIWGSAQG 602

  Fly   278 KEGMTAFAEKRPAKF 292
            .:.|..:.:::..:|
  Rat   603 MDSMLKYLQRKIDEF 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 61/266 (23%)
CdylXP_017456089.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.