DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and CG4592

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001260306.1 Gene:CG4592 / 34317 FlyBaseID:FBgn0032162 Length:287 Species:Drosophila melanogaster


Alignment Length:270 Identity:62/270 - (22%)
Similarity:106/270 - (39%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSE 96
            |..|.....:.|....:...:..:::|.| .:|.|...||.:|..::.|...:|:...|:.:.::
  Fly    25 SLANGATSKLTTIEVDDRSGIATLSMNLP-PVNTLTMELMHDLIDSINQIESNKSRGLILTSSND 88

  Fly    97 KAFAAGADIKEMVGNTYS--QCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYA 159
            |.|:||.|:.||:.....  :.....|.:.|..:.....|..||:||::...||.||..|:.   
  Fly    89 KVFSAGLDLNEMLNPDVERLRLFWTRFQDLWLALHLCGLPTAAAINGHSPAAGCVLATACEY--- 150

  Fly   160 GDKAKFGQPEIALGTIPGAGGTQRLTRVVGK-----------SKAMEMCLT-GNMIGAQEAEKLG 212
                :...|.:.:|.     ...|.:.|:.|           .:.:|..|. |.:..:|||..:|
  Fly   151 ----RVMLPNLFIGI-----HATRFSFVISKWMMNSYQSVLPRRIVERALNQGKLFASQEALDVG 206

  Fly   213 LASKVVPADQLLGEAV-KLGEKIGTHSN-------LIVQLC----------------KEAVNTAY 253
            |..::..:.:   ||: |....|.|...       |..::|                ||.|:  |
  Fly   207 LVDEIACSKE---EALSKCAAFIATFDKTNPVARCLTKRMCREPDVRELLQDRAADLKECVD--Y 266

  Fly   254 ETT--LQEGL 261
            .||  .||||
  Fly   267 VTTPLFQEGL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 60/265 (23%)
CG4592NP_001260306.1 crotonase-like 43..284 CDD:304874 59/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.