DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and CG4598

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster


Alignment Length:288 Identity:74/288 - (25%)
Similarity:120/288 - (41%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RQPQVATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDK 85
            |....||:.::...|:     ||.:|       .:|:||| .:|.|...|:::|.:::.:...:|
  Fly    17 RMMSTATKLTTVEVND-----KTGIA-------TLTMNRP-PVNGLNLELLQDLKSSIDEIESNK 68

  Fly    86 TISAIVLTGSEKAFAAGADIKEM-------VGNTYSQCIQGNFLND-WTEVARTQKPIIAAVNGY 142
            :...|:.:.|...|:||.||.||       :...::|      |.| |..:..:..|..||:||:
  Fly    69 SRGLILTSSSSTIFSAGLDILEMYKPDKDRIRAFWTQ------LQDTWLALYGSSVPTAAAINGH 127

  Fly   143 ALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQE 207
            :..|||.||..|:..........|..|..||.:...........|:.:..|......|.|...:|
  Fly   128 SPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEE 192

  Fly   208 AEKLGLASKVVPADQLLGEAVKLGEK----IGTHSN---LIVQLCKEAVNTAYETTLQEGLKFER 265
            |.|:||..:.....:   ||:   ||    |||.:.   |...|.|:....|....||.|.|.:.
  Fly   193 ALKVGLIDETANNKE---EAI---EKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDL 251

  Fly   266 RTFHATFSTADRKEGMTAFAE--KRPAK 291
            ..|....:....::|:..:.|  |:.||
  Fly   252 EKFLFFVNQPAVQKGLGIYLEGLKKKAK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 70/272 (26%)
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 54/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.