DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Mtpalpha

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster


Alignment Length:318 Identity:95/318 - (29%)
Similarity:145/318 - (45%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRAQCVLQAAAR----QPQVATRFSSSSTN-----NNWEYIKTEVAGEGKNVGVITLNRPKALNA 65
            ||.|.:.....|    ..|:..|....|||     |  :::.|:|.   ..|.||.::.|   ||
  Fly    14 SRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVAN--KHLHTKVV---NGVLVIKIDSP---NA 70

  Fly    66 LCNGLMKELSTALQQFSKD-----KTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDW 125
            ..|.|..|:|...::..||     ...||::::|....|.|||||..:.....::  :...::..
  Fly    71 KVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEACQTAE--EATLISHG 133

  Fly   126 TEV-----ARTQKPIIAAVNGYALGGGCELAMMCD--IIYAGDKAKFGQPEIALGTIPGAGGTQR 183
            .:|     .|::|||:||::|..||||.|||:.|.  |.....|.|.|.||:.||.:||.|||.|
  Fly   134 AQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVR 198

  Fly   184 LTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEA 248
            |.::.....|::|.|||..:.|..|::||:...:|..   ||..::..|:     |.|..|.|.|
  Fly   199 LPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDP---LGPGLQPAEQ-----NTIEYLEKTA 255

  Fly   249 VNTAYETTL--------QEGLKFERRTF--------HATFSTADRKEGMTAFAEKRPA 290
            |..|.:...        :.||..:.::|        :..|.|| ||:.:.|.....||
  Fly   256 VQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTA-RKQVLKASNGLYPA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 85/282 (30%)
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 89/294 (30%)
crotonase-like 52..235 CDD:119339 64/190 (34%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.