DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and eci1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001292513.1 Gene:eci1 / 334101 ZFINID:ZDB-GENE-030131-6033 Length:301 Species:Danio rerio


Alignment Length:225 Identity:61/225 - (27%)
Similarity:101/225 - (44%) Gaps:24/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLT 93
            :|:||.      ||.:: .....|.|:....| .:|:|....:.|.:..|::...|::...:::|
Zfish    40 YSTSSK------IKVDL-DSSNGVAVLQFQSP-PVNSLSLDFLTEFAINLEKLELDRSCRGVIIT 96

  Fly    94 GSE-KAFAAGADIKEMVGNTYSQC------IQGNFLNDWTEVARTQKPIIAAVNGYALGGGCELA 151
            .:: |.|:||.||.||...:...|      :|    ..|.::..:.|..|||:||.:..|||.||
Zfish    97 SAQPKVFSAGLDILEMYQKSPEHCAEFWKAVQ----EAWLKLYGSSKVTIAAINGNSPAGGCLLA 157

  Fly   152 MMCDIIYAGDKAKF--GQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLA 214
            |.||.....|..::  |..|..||.:........:..|||..:..:....|.:.....|.|:||.
Zfish   158 MCCDYRIMADNPRYSIGLNETQLGIVAPFWFKDTMLNVVGHRETEKGLQLGLLYNTPNALKIGLV 222

  Fly   215 SKVVPADQLLGEAVKLGEK---IGTHSNLI 241
            .::||.|::|..|.:...|   |..|:..|
Zfish   223 DELVPEDKVLSTAAETMTKWLAIPDHARQI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 58/217 (27%)
eci1NP_001292513.1 crotonase-like 53..297 CDD:304874 56/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.