DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and CG14787

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster


Alignment Length:167 Identity:37/167 - (22%)
Similarity:63/167 - (37%) Gaps:38/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ELSTALQQFSKDKTISAIVLTGSEKAFAAG------------------ADIKEMVGN-----TYS 114
            ||..||...|.|..:..:||:|...|...|                  |..:|.||:     .|.
  Fly    37 ELMRALDLASADAAVKVVVLSGEFSAACGGEMEPLALKQGLENRSRRTASHEEAVGSGDAEEQYI 101

  Fly   115 QCIQGNFLNDWTEVART----QKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFG------QPE 169
            .....||:  ...:|:.    :|.::|.|....:|.|..:..:||:::|.:.:.|.      .|.
  Fly   102 HEKAANFV--MRSLAKKLLVHRKLLVAFVERQCVGLGLSVCSLCDLVFATELSAFVPAFSHLDPC 164

  Fly   170 IALG---TIPGAGGTQRLTRVVGKSKAMEMCLTGNMI 203
            ..:|   |:|......||......|.|::..|..:::
  Fly   165 TKVGPGWTVPHVHWLLRLGDQASSSIALQCGLVASVV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 37/167 (22%)
CG14787NP_569914.2 crotonase-like 13..216 CDD:304874 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.