DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and HIBCH

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_055177.2 Gene:HIBCH / 26275 HGNCID:4908 Length:386 Species:Homo sapiens


Alignment Length:346 Identity:83/346 - (23%)
Similarity:137/346 - (39%) Gaps:91/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QVATRFSS-SSTNNNWEYIK--------TEVAGEGKN-VGVITLNRPKALNALCNGLMKELSTAL 78
            ::.:||:: ..||....:::        .||..|.|. .|||||||||.||||...:::::...|
Human     8 RLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNALTLNMIRQIYPQL 72

  Fly    79 QQFSKDKTISAIVLTGS-EKAFAAGADI---------KEMVGNTYSQCIQGNFLNDWTEVARTQK 133
            :::.:|.....|::.|: .|||.||.||         |:.:...:.:  :...||:  .|...||
Human    73 KKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFR--EEYMLNN--AVGSCQK 133

  Fly   134 PIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCL 198
            |.:|.::|..:|||..|::......|.:|..|..||.|:|..|..||...|.|:.|| ....:.|
Human   134 PYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGK-LGYFLAL 197

  Fly   199 TGNMIGAQEAEKLGLASKVVPADQL--------------------LGEAVKLGEKIGTHSNLIVQ 243
            ||..:..::..:.|:|:..|.:::|                    :.|......||....:.|::
Human   198 TGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILE 262

  Fly   244 LCKEAVNTAYET----------------------------------------------TLQEGLK 262
            ...:.:|:.:..                                              ||||.|.
Human   263 EHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLT 327

  Fly   263 FERRTFHATFSTADRKEGMTA 283
            .|.|...|.....|..||:.|
Human   328 MEYRLSQACMRGHDFHEGVRA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 79/332 (24%)
HIBCHNP_055177.2 PRK05617 34..378 CDD:235533 79/320 (25%)
ECH_2 47..375 CDD:292731 75/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.