DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Hibch

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_666220.1 Gene:Hibch / 227095 MGIID:1923792 Length:385 Species:Mus musculus


Alignment Length:303 Identity:72/303 - (23%)
Similarity:119/303 - (39%) Gaps:73/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGS-EKAFAAGADIKEM--VGNTYS 114
            |||||||||.||||...:::::...|:.:.:|.....|::.|: .|||.||.|||.:  ......
Mouse    46 GVITLNRPKFLNALSLNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQ 110

  Fly   115 QCIQGNFLNDW---TEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIP 176
            ...|..|..::   ..:|..|||.:|.::|..:|||..|::......|.:::.|..||..:|..|
Mouse   111 NLTQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFP 175

  Fly   177 GAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQL------------------ 223
            ..||...|.|:.|| ....:.|||..:..::..:.|:|:..|.:::|                  
Mouse   176 DVGGGYFLPRLQGK-LGYFLALTGYRLKGRDVHRAGIATHFVDSEKLRVLEEELLALKSPSAEDV 239

  Fly   224 --LGEAVKLGEKIGTHSNLIVQLCKEAVNTAYET------------------------------- 255
              :.|:.....|:....::|.:...:.:|:.:..                               
Mouse   240 AGVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQIIENLRQDGSPFAIEQMKVINKMSPT 304

  Fly   256 ---------------TLQEGLKFERRTFHATFSTADRKEGMTA 283
                           ||||.|..|.|...|.....|..||:.|
Mouse   305 SLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGHDFHEGVRA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 72/303 (24%)
HibchNP_666220.1 PRK05617 33..377 CDD:235533 72/303 (24%)
ECH_2 46..374 CDD:292731 72/303 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.