DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and EHHADH

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001957.2 Gene:EHHADH / 1962 HGNCID:3247 Length:723 Species:Homo sapiens


Alignment Length:295 Identity:88/295 - (29%)
Similarity:136/295 - (46%) Gaps:55/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGA 103
            ||.:...|     :.:|.|..| .:||:...|::::...||:...|.||.|||:.|:|..|:|||
Human     3 EYTRLHNA-----LALIRLRNP-PVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGA 61

  Fly   104 DIK-----EMVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKA 163
            ||:     ...|.|....:.        |:.|.:||::||:.|.|.|||.|||:.|....|..:|
Human    62 DIRGFSAPRTFGLTLGHVVD--------EIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEA 118

  Fly   164 KFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAV 228
            :.|.||:.||.:|||.|||.|.|:.|...|:::..:|..|.|.||.|||:..|||.:|. :.||:
Human   119 QVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDP-VEEAI 182

  Fly   229 KLGEKIG---------------------------------THSNLIVQ-LCKEAVNTAYETTLQE 259
            :..:::.                                 .|...:.| .|..||..|.:...:.
Human   183 RFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEV 247

  Fly   260 GLKFERRTFHATFSTADRKEGMTA-FAEKRPAKFT 293
            |:|.|...|.....:...:....| |||::..|::
Human   248 GIKKEEELFLYLLQSGQARALQYAFFAERKANKWS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 88/295 (30%)
EHHADHNP_001957.2 Enoyl-CoA hydratase / isomerase 1..282 88/293 (30%)
fadJ 20..705 CDD:333311 82/272 (30%)
3-hydroxyacyl-CoA dehydrogenase 283..572 88/295 (30%)
Microbody targeting signal 721..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.