DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ech-9

DIOPT Version :10

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_501875.2 Gene:ech-9 / 184065 WormBaseID:WBGene00001158 Length:434 Species:Caenorhabditis elegans


Alignment Length:78 Identity:17/78 - (21%)
Similarity:22/78 - (28%) Gaps:44/78 - (56%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEAVKLGEKIGTHSNLIV- 242
            |||.        .|||.:|             .|||                    |..:.|:| 
 Worm    47 GGTM--------GKAMAIC-------------FGLA--------------------GIETFLVVR 70

  Fly   243 --QLCKEAVNTAY 253
              |.||:.:...|
 Worm    71 NEQRCKQELEVMY 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:474030 17/78 (22%)
ech-9NP_501875.2 FadB 38..307 CDD:440862 17/78 (22%)
3HCDH 343..>397 CDD:395588
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.