DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ech-1.1

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_506810.1 Gene:ech-1.1 / 180037 WormBaseID:WBGene00001150 Length:755 Species:Caenorhabditis elegans


Alignment Length:281 Identity:80/281 - (28%)
Similarity:132/281 - (46%) Gaps:34/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKAL-NALCNGLMKELSTALQQFSKDKTISAI-V 91
            |:..||:      :.|..|:   |.|:.::.|... |.|...|..|::..|.:...|:::.|| |
 Worm    27 FAVHSTH------RVEKQGD---VAVMKIDLPNTTENVLNKALFAEMNETLDRLQSDQSVKAIVV 82

  Fly    92 LTGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDWTE----VARTQKPIIAAVNGYALGGGCELAM 152
            ::|...:|.|||||:.......:..: .|.|.:..:    :..:||||:||:.|..:|||.|:|:
 Worm    83 MSGKPNSFVAGADIQMFKAEKTAAGV-SNLLREGQKQLLTIELSQKPIVAAIMGSCMGGGLEIAL 146

  Fly   153 MCD--IIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLAS 215
            .|.  |.....|...|.||:.||.:||.||||||.::......:::.|||..|.|.:|.|:|:..
 Worm   147 ACHYRIAVNDKKTLLGLPEVTLGIMPGDGGTQRLPKLTTVQNVLDLTLTGKRIKANKAMKIGIVD 211

  Fly   216 KVVPADQLLGEAVKLGEKIGTH---SNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADR 277
            :|:   |.||:.:....:. ||   ..:.||..:|..|...:....:|.     ..:||.:....
 Worm   212 RVI---QPLGDGICTSTET-THKYLEEIAVQSARELANGKLKINRDKGF-----VHNATQAVMTS 267

  Fly   278 K----EGMTAFAEKRPAKFTN 294
            |    ..:...|:.:..|.||
 Worm   268 KFVLDNVILKMAKNKLIKLTN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 75/271 (28%)
ech-1.1NP_506810.1 fa_ox_alpha_mit 20..754 CDD:131494 80/281 (28%)
crotonase-like 34..216 CDD:119339 60/188 (32%)
3HCDH_N 355..533 CDD:280833
3HCDH 535..630 CDD:279114
3HCDH 668..754 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.