DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ech-8

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_501876.2 Gene:ech-8 / 177905 WormBaseID:WBGene00001157 Length:437 Species:Caenorhabditis elegans


Alignment Length:225 Identity:48/225 - (21%)
Similarity:75/225 - (33%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VATRFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQ---QFSKDKT 86
            :|..|..|........:..:.|...||...||..|.||...|.:..:::|...||   .|.|...
 Worm    54 IAIAFCLSGFETYLVEVNNKAAEFCKNELEITYKREKAFRRLNDSKVEKLRKNLQITTDFQKLNN 118

  Fly    87 ISAIVLTGSEKAFAAGADIKEMVGN----TYSQCIQGN-----FLNDWTEVARTQKPIIAAVNGY 142
            ...||    |..|......||:...    ....||.|.     .||:.:.|.|....::    |.
 Worm   119 CDLIV----EAVFEDMKLKKELFTKLDKICKPSCIFGTNTSSLDLNEMSSVLRDPTKVV----GI 175

  Fly   143 ALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQE 207
            .......|..|.::||                     |::..::.|  :.|.|.|        :.
 Worm   176 HFFNPANLIRMVEVIY---------------------GSKTSSKAV--ATAFEAC--------RS 209

  Fly   208 AEKLGLASKVVPA---DQLLGEAVKLGEKI 234
            .:||.:.....||   ::|||..:...:|:
 Worm   210 IKKLPVLVGNCPAFVFNRLLGVYLNQSQKL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 45/213 (21%)
ech-8NP_501876.2 FadB 38..312 CDD:224170 48/225 (21%)
3HCDH_N 41..220 CDD:280833 42/204 (21%)
3HCDH 223..310 CDD:279114 4/17 (24%)
3HCDH 347..>391 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.