DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and Cdyl

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:274 Identity:64/274 - (23%)
Similarity:124/274 - (45%) Gaps:13/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RFSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVL 92
            |||...|.:.:.|....|..:.....::...:....|:|...:|||:.:||...:.|.: ..::|
Mouse   324 RFSVRQTESAYRYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLL 387

  Fly    93 TGSEKAFAAGAD----IKEMVGNTYSQCIQ-----GNFLNDWTEVARTQKPIIAAVNGYALGGGC 148
            :.....|..|.|    |:.:..:...:..:     .||:|.:.:.   :||||.||||.|:|.|.
Mouse   388 SAVGSVFCCGLDFIYFIRRLTDDRKRESTKMADAIRNFVNTFIQF---KKPIIVAVNGPAIGLGA 449

  Fly   149 ELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGL 213
            .:..:||:::|.:||.|..|....|..|....|....:::|.:.|.||..:|..:.||||...||
Mouse   450 SILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGL 514

  Fly   214 ASKVVPADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRK 278
            .|:|........|.:...:::.:.:.::::..|..|....:..|::..:.|.......:.:|...
Mouse   515 VSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGM 579

  Fly   279 EGMTAFAEKRPAKF 292
            :.|..:.:::..:|
Mouse   580 DSMLKYLQRKIDEF 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 60/265 (23%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339 52/199 (26%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589 57/235 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.