DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ECI2

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens


Alignment Length:289 Identity:79/289 - (27%)
Similarity:117/289 - (40%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AARQPQV------ATRFSSSS-----TNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMK 72
            ||||..|      :....|||     |:......:|.|......:..|..||||..||:...:..
Human   106 AARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH 170

  Fly    73 ELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNFLNDWTEV--------A 129
            |:..||:..|||.:| ..||||:              |:.||   .||.|.::|::        |
Human   171 EIMRALKAASKDDSI-ITVLTGN--------------GDYYS---SGNDLTNFTDIPPGGVEEKA 217

  Fly   130 RTQ---------------KPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAG 179
            :..               ||:||.|||.|:|....|..:.|.:||.|:|.|..|...||..|...
Human   218 KNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGC 282

  Fly   180 GTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEA---VKLGEKIGTHSNLI 241
            .:....:::..:||.||.:.|..:.|.||...||.::|.|......|.   :|...|:..::   
Human   283 SSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNA--- 344

  Fly   242 VQLCKEAVNTAYETTLQEGLKFERRTFHA 270
            :::.||.:.           |.||...||
Human   345 LRISKEVIR-----------KREREKLHA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 70/260 (27%)
ECI2NP_996667.2 ACBP 40..113 CDD:279259 4/6 (67%)
Acyl-CoA binding. /evidence=ECO:0000250 66..70
crotonase-like 142..335 CDD:119339 60/210 (29%)
ECH-like 151..322 57/188 (30%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 198..202 2/3 (67%)
Microbody targeting signal. /evidence=ECO:0000255 392..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.