DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Echs1 and ehhadh

DIOPT Version :9

Sequence 1:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_996951.1 Gene:ehhadh / 100000859 ZFINID:ZDB-GENE-040426-2581 Length:718 Species:Danio rerio


Alignment Length:287 Identity:85/287 - (29%)
Similarity:141/287 - (49%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAG 102
            :|.:|       ::|.:|||..| .:|||.:.:...:|..:::...|..::|:|:.|....|..|
Zfish     4 YELVK-------RSVALITLTNP-PVNALSSAVRHAISKTMERALSDPKVTAVVICGENGRFCGG 60

  Fly   103 ADIKEMVGNTYSQCIQGNFLNDWTE-VARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFG 166
            |||:|..|.     ::|..|....: :...:||::||:.|.|||||.|||::|....|..||:.|
Zfish    61 ADIREFAGP-----LRGPPLVPLLDAIEAGEKPVVAAIEGVALGGGFELALVCHYRIAHYKARLG 120

  Fly   167 QPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVV---PADQLLGEAV 228
            .||:.||.:|.|||||||.|::|...|:|:..||..:.||||.|||:..:|.   ..:..|..|:
Zfish   121 LPEVTLGILPAAGGTQRLPRLIGIPAALELITTGRHVSAQEALKLGMVDQVTEQNTCEVALEFAL 185

  Fly   229 K-LGEKIGTHS-NLIVQLCKEAVNTAYE-TTLQ--------------------------EGLKFE 264
            | :|:.:.:.. :::...|...::..:| .|:|                          ||:|.|
Zfish   186 KAVGKPLSSRRLSMLTTPCPPGLDGIFEAATMQVQKKARGVMAPLACVQAVRAATLPYSEGIKRE 250

  Fly   265 RRTFHATFSTADRKEGMTAFAEKRPAK 291
            .......||:...:....:|..:|.|:
Zfish   251 GELMATLFSSGQAQALQYSFFAQRTAE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 85/287 (30%)
ehhadhNP_996951.1 Enoyl-CoA hydratase / isomerase 2..280 85/287 (30%)
fadJ 11..702 CDD:236864 83/273 (30%)
crotonase-like 11..186 CDD:119339 68/180 (38%)
3-hydroxyacyl-CoA dehydrogenase 281..567
3HCDH_N 297..471 CDD:280833
3HCDH 473..577 CDD:279114
3HCDH 617..700 CDD:279114
Microbody targeting signal. /evidence=ECO:0000250 716..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.