DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syngr and SYNGR2

DIOPT Version :9

Sequence 1:NP_610908.1 Gene:Syngr / 36533 FlyBaseID:FBgn0033876 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001350707.1 Gene:SYNGR2 / 9144 HGNCID:11499 Length:275 Species:Homo sapiens


Alignment Length:156 Identity:71/156 - (45%)
Similarity:105/156 - (67%) Gaps:2/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GAYGGGKAGGAFDPLTFAMKPQVVIRALCWLFSVVVFGCISSEGWTE-KDGKE-YCLYNGDGMAC 76
            ||||..||||:||...|..:||||.||:|.:|:::||.||..||::. .:.|: ||::|.:..||
Human     4 GAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDAC 68

  Fly    77 KYGNMVGVFGFLASMGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQWSSS 141
            :||:.:||..||||..|:..:..|.::|:...||..|:.|:.|||||||::||.|.:|.:||:.:
Human    69 RYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVT 133

  Fly   142 APPPLGIGAGSMKTAIWFCLFSIVSW 167
            .|..:.:||.|::.||.|..|||.||
Human   134 NPKDVLVGADSVRAAITFSFFSIFSW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyngrNP_610908.1 MARVEL 34..169 CDD:307448 60/136 (44%)
SYNGR2NP_001350707.1 MARVEL 20..161 CDD:307448 61/140 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157820
Domainoid 1 1.000 127 1.000 Domainoid score I5355
eggNOG 1 0.900 - - E1_KOG4016
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4079
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45451
OrthoDB 1 1.010 - - D1549362at2759
OrthoFinder 1 1.000 - - FOG0001420
OrthoInspector 1 1.000 - - otm40745
orthoMCL 1 0.900 - - OOG6_104437
Panther 1 1.100 - - O PTHR10838
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X989
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.