DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syngr and Syngr2

DIOPT Version :9

Sequence 1:NP_610908.1 Gene:Syngr / 36533 FlyBaseID:FBgn0033876 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_033330.1 Gene:Syngr2 / 20973 MGIID:1328324 Length:224 Species:Mus musculus


Alignment Length:231 Identity:87/231 - (37%)
Similarity:129/231 - (55%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GAYGGGKAGGAFDPLTFAMKPQVVIRALCWLFSVVVFGCISSEGWT--EKDGKEYCLYNGDGMAC 76
            ||||...|||:||...|..:||||.|.:..:.:::||.||..||:|  ....:.||::|.:..||
Mouse     4 GAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDAC 68

  Fly    77 KYGNMVGVFGFLASMGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQWSSS 141
            :||:.:||..||||..|:..:..|.::|:...||..|:.|:.|||||||::||.|.:|.:||:::
Mouse    69 RYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAAT 133

  Fly   142 APPPLGIGAGSMKTAIWFCLFSIVSWALCALMAYKRFLIGAGDEFTSAFETDPA---NVVHQQAY 203
            .|..:.:||.|.:.||.|..|||.||.:.|.:||:|:..|. |.|...: .||.   |..:....
Mouse   134 KPQDVRVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGV-DAFIQNY-VDPTPDPNTAYASYP 196

  Fly   204 GYSMDNDNDQYSASPFGQPQQGGMEQQQSGMEYQQP 239
            ..|::|    |...||.|    .:|..:.   ||.|
Mouse   197 SASVEN----YQQPPFTQ----NVETTEG---YQPP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyngrNP_610908.1 MARVEL 34..169 CDD:307448 57/136 (42%)
Syngr2NP_033330.1 MARVEL 20..165 CDD:307448 59/144 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848205
Domainoid 1 1.000 121 1.000 Domainoid score I5675
eggNOG 1 0.900 - - E1_KOG4016
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4169
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45451
OrthoDB 1 1.010 - - D1549362at2759
OrthoFinder 1 1.000 - - FOG0001420
OrthoInspector 1 1.000 - - otm42818
orthoMCL 1 0.900 - - OOG6_104437
Panther 1 1.100 - - LDO PTHR10838
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X989
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.