DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syngr and syngr4

DIOPT Version :9

Sequence 1:NP_610908.1 Gene:Syngr / 36533 FlyBaseID:FBgn0033876 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_017951013.1 Gene:syngr4 / 100497583 XenbaseID:XB-GENE-5803519 Length:239 Species:Xenopus tropicalis


Alignment Length:153 Identity:40/153 - (26%)
Similarity:71/153 - (46%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTFAMKPQVVIRALCWLFSVVVFGCISSEGWTEKDGKEY--CLYNGDGMACKYGNMVGVFGFLAS 90
            |.|.::|..:.|.|..:.|::|...:.|.|:.......:  |..|.:..||:||..:|:||.:..
 Frog    21 LAFLLRPLTIWRVLTLICSIIVCASLLSGGYQNLPTSSFLNCTLNDNNTACEYGISIGIFGSIVC 85

  Fly    91 MGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQWSSSAPPPLGIGAGSMKT 155
            :.|:..:.....:....|:|...:.|:.||.::|.::...|.:|..:||.|.|.....|....:|
 Frog    86 LVFVALDISKPLLKMDLSKKAISITDIFFSVVFTLLWLFGFCFLTHEWSMSLPYVFAFGKEHAET 150

  Fly   156 AIWFCLFSIVSWALCALMAYKRF 178
            ||.|..||.:.|.:...:....|
 Frog   151 AIAFSFFSTLCWVILIYLQVSHF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyngrNP_610908.1 MARVEL 34..169 CDD:307448 37/136 (27%)
syngr4XP_017951013.1 MARVEL 23..168 CDD:366555 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.