DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syngr and syngr3

DIOPT Version :9

Sequence 1:NP_610908.1 Gene:Syngr / 36533 FlyBaseID:FBgn0033876 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_002932489.1 Gene:syngr3 / 100489723 XenbaseID:XB-GENE-949635 Length:227 Species:Xenopus tropicalis


Alignment Length:239 Identity:90/239 - (37%)
Similarity:133/239 - (55%) Gaps:24/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGAYGGGKAGGAFDPLTFAMKPQVVIRALCWLFSVVVFGCISSEGWTEKDGKE-YCLYNGDGMAC 76
            |.::|.|:|||.|:|:.|..:||.::|.:.|:||:||||.:.:||....|..| ||:||.:..||
 Frog     3 GASFGAGRAGGGFEPVEFLKQPQTILRIISWVFSIVVFGSLVNEGSINVDSPELYCVYNQNDDAC 67

  Fly    77 KYGNMVGVFGFLASMGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQW--- 138
            .|...:||..|.||:.|...:..|.::||||.||:.||.|:||||:|:|::||:|.:|..||   
 Frog    68 NYAITIGVVAFFASICFFVVDIYFPQISSVKDRKKAVMIDIGFSAIWSFLWFVSFCFLADQWRKT 132

  Fly   139 SSSAPPPLGIGAGSMKTAIWFCLFSIVSWALCALMAYKRFLIG------AGDEFTSAFETDPANV 197
            |...|.    ||.:.:..|.|..||:.||...|:.|.:|:.:|      |||:|.||    |...
 Frog   133 SYDVPQ----GADAARAGIVFSFFSVFSWCASAVKAMQRYRLGTDMSLFAGDQFGSA----PNAG 189

  Fly   198 VHQQAYGYSMDNDNDQYSASPFGQPQQGGMEQQQSGMEYQQPTY 241
            ......|..:::..|.|.:.||.:    .|:....|  ||.|:|
 Frog   190 YPGYPTGSGIESTTDTYQSPPFTE----NMDSSTKG--YQVPSY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyngrNP_610908.1 MARVEL 34..169 CDD:307448 59/138 (43%)
syngr3XP_002932489.1 MARVEL 20..162 CDD:366555 60/145 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5686
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4161
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549362at2759
OrthoFinder 1 1.000 - - FOG0001420
OrthoInspector 1 1.000 - - otm47928
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2805
SonicParanoid 1 1.000 - - X989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.