DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syngr and syngr1b

DIOPT Version :9

Sequence 1:NP_610908.1 Gene:Syngr / 36533 FlyBaseID:FBgn0033876 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_002662287.3 Gene:syngr1b / 100321965 ZFINID:ZDB-GENE-090624-2 Length:193 Species:Danio rerio


Alignment Length:151 Identity:60/151 - (39%)
Similarity:95/151 - (62%) Gaps:4/151 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GAFDPLTFAMKPQVVIRALCWLFSVVVFGCISSEGWTEK--DGKEYCLYNGDGMACKYGNMVGVF 85
            |:|:.|||..:|...:|.||||||:|:.|||::||...:  :.:::|::|.:..||.|...:...
Zfish     7 GSFELLTFIQQPHTGLRILCWLFSLVILGCIANEGQINRPDEVQKFCIFNRNQNACNYALGMASL 71

  Fly    86 GFLASMGFMGGEFLFERMSSVKSRKRYVMADMGFSALWTFMYFVAFLYLWSQWSSS--APPPLGI 148
            .|:..:.|:..:..|.::||:|.||:.|:||:|.||.|:|::||.|.:|.:||..|  ...||..
Zfish    72 AFIWCLLFLAIDVHFPQISSIKHRKKVVLADVGTSAFWSFVWFVGFCFLANQWQVSRVEDDPLRS 136

  Fly   149 GAGSMKTAIWFCLFSIVSWAL 169
            |..:.:.||.||.|||.|||:
Zfish   137 GGDAARAAITFCFFSIFSWAV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SyngrNP_610908.1 MARVEL 34..169 CDD:307448 54/138 (39%)
syngr1bXP_002662287.3 MARVEL 14..159 CDD:279608 56/144 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593611
Domainoid 1 1.000 124 1.000 Domainoid score I5443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4175
OMA 1 1.010 - - QHG45451
OrthoDB 1 1.010 - - D1549362at2759
OrthoFinder 1 1.000 - - FOG0001420
OrthoInspector 1 1.000 - - otm25361
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10838
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.