DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and AT3G19400

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:187 Identity:41/187 - (21%)
Similarity:72/187 - (38%) Gaps:65/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSARILLGVPLLLYLMGVALGVPVSTSSPATQKINPEIGVTTGKSDADSSTPTIEHTSGLSEFE 65
            :.||.::|.|.||...:|||....:..:                                    |
plant     9 IVSALVILSVLLLSSSLGVATETEIERN------------------------------------E 37

  Fly    66 EECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFE 130
            .|.:..::::||:...:|:...|:::|..||.:|.:.|.:||...|.   :|:.|:.:::|||.|
plant    38 TEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDR---TFEVGLTRFADLTNE 99

  Fly   131 EWKEKQTPKVMPEIASESSKEER-------------------------DKVNCQAAW 162
            |::.....|.| |...:|.|.||                         |:.||.:.|
plant   100 EFRAIYLRKKM-ERTKDSVKTERYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 18/59 (31%)
Inhibitor_I29 162..221 CDD:214853 1/1 (100%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 17/58 (29%)
Peptidase_C1 130..348 CDD:425470 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.