DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Cts8

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001121688.1 Gene:Cts8 / 680718 RGDID:1588248 Length:333 Species:Rattus norvegicus


Alignment Length:143 Identity:35/143 - (24%)
Similarity:66/143 - (46%) Gaps:41/143 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLLLYLMGVALGVPVSTSSPATQKINPEIGVTTGKSDADSSTPTIEHTSGLSEFEEECQFAWQRF 75
            |::| |..:.|||     :.|||..:|.:         ||.                    ||.:
  Rat     3 PVVL-LAILCLGV-----ARATQPSDPSL---------DSE--------------------WQEW 32

  Fly    76 LVDFDVHYDNDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEEWKEKQTPKV 140
            ...::.:|..:.|.|||. ::.||.:.|:.||::||....:|...:|.::|:|.||::     |:
  Rat    33 KTKYEKNYSLEEEGQKRA-VWEENMKVVKQHNIEYDQEKKNFTMELNAFADMTGEEFR-----KM 91

  Fly   141 MPEIASESSKEER 153
            |..|..::.::::
  Rat    92 MTNIPVQNLRKKK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 19/59 (32%)
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
Cts8NP_001121688.1 Inhibitor_I29 29..87 CDD:214853 18/58 (31%)
Peptidase_C1A 115..331 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.