DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsb

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:284 Identity:51/284 - (17%)
Similarity:79/284 - (27%) Gaps:141/284 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VSFKKGIN---------QWSDLTFEEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLIDFG 170
            |.|.:.||         |||:              .|.||     :.||:.:|.:.|.     ||
  Rat    72 VGFSEDINLPESFDAREQWSN--------------CPTIA-----QIRDQGSCGSCWA-----FG 112

  Fly   171 AQYKNANETEKRRNVFC--ANWRAIVEHNVQ-----------------YEKWAEPFKRDINQWT- 215
            |       .|...:..|  .|.|..||.:.:                 |...|..|      || 
  Rat   113 A-------VEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNF------WTR 164

  Fly   216 -----------------------DHTIEERSSPAPEIRKEEATTSTSEIDNDNIICQPAWEKFLI 257
                                   :|.:.....|.         |...:....|.:|:..      
  Rat   165 KGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPC---------TGEGDTPKCNKMCEAG------ 214

  Fly   258 DFKPSYQDD----------TETEKR------RN--------VFCD--NFKS-IHKHNVQFDLGNI 295
             :..||::|          :::||.      :|        ||.|  .:|| ::||.....:|..
  Rat   215 -YSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGH 278

  Fly   296 SFK-------KGINQWSDLTVEEW 312
            :.:       .|:..|  |....|
  Rat   279 AIRILGWGIENGVPYW--LVANSW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 7/25 (28%)
Inhibitor_I29 162..221 CDD:214853 16/101 (16%)
Inhibitor_I29 252..311 CDD:214853 17/92 (18%)
Inhibitor_I29 347..406 CDD:214853
CtsbNP_072119.2 Propeptide_C1 26..65 CDD:285358
Peptidase_C1A_CathepsinB 81..328 CDD:239111 47/275 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.