DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsm

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_071721.2 Gene:Ctsm / 64139 MGIID:1927229 Length:333 Species:Mus musculus


Alignment Length:88 Identity:27/88 - (30%)
Similarity:44/88 - (50%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 DNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTV 404
            |......|:|:.|.:|..|..|:|.:| |.::.||.|.|:.||.:..||...|...:|.:.|:|:
Mouse    22 DPILDVEWQKWKIKYGKAYSLEEEGQK-RAVWEDNMKKIKLHNGENGLGKHGFTMEMNAFGDMTL 85

  Fly   405 EEWKTKQRPNLAPEFSKEETTTK 427
            ||::........|...|.::..|
Mouse    86 EEFRKVMIEIPVPTVKKGKSVQK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 21/58 (36%)
CtsmNP_071721.2 Inhibitor_I29 29..87 CDD:214853 21/58 (36%)
Peptidase_C1A 115..331 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.