Sequence 1: | NP_610907.1 | Gene: | CG6357 / 36532 | FlyBaseID: | FBgn0033875 | Length: | 439 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021336916.1 | Gene: | ctso / 567333 | ZFINID: | ZDB-GENE-080724-8 | Length: | 334 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 39/207 - (18%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 54/207 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 RKEEATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGN 294
Fly 295 ISFKKGINQWSDLTVEEWKNK---QRPAFNPEF--SKVEATTKISKDKRDD-------------N 341
Fly 342 TCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTVEE 406
Fly 407 WKTKQRPNLAPE 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6357 | NP_610907.1 | Inhibitor_I29 | 72..132 | CDD:285458 | |
Inhibitor_I29 | 162..221 | CDD:214853 | |||
Inhibitor_I29 | 252..311 | CDD:214853 | 14/58 (24%) | ||
Inhibitor_I29 | 347..406 | CDD:214853 | 7/58 (12%) | ||
ctso | XP_021336916.1 | Peptidase_C1A | 122..327 | CDD:239068 | 14/96 (15%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4870 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |