DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and si:dkey-228a15.1

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_017207744.1 Gene:si:dkey-228a15.1 / 564472 ZFINID:ZDB-GENE-060503-344 Length:313 Species:Danio rerio


Alignment Length:332 Identity:67/332 - (20%)
Similarity:119/332 - (35%) Gaps:88/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SPATQKINPEIGVTTGKSDADSSTPTIEHTSGLSEFEEECQF-AWQRFLVDFDVHYDN-DYERQK 91
            :||..:..|:.|          ....::....|..:|.|..| ||    .||:.:... ||....
Zfish    25 NPAGNRTVPDFG----------KMYYVKGVISLPSYEIEEPFEAW----YDFEGNRSRIDYYNGT 75

  Fly    92 RRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDL-TFEEWKEKQTP----KVMPEIAS-ESSK 150
            .|.....|         ..|.|.:...|.:...||: .|:....|:.|    ..||::.. |..|
Zfish    76 TRTFLIGN---------DLDYGAIYQIKPVLPPSDIKCFQLKGTKEEPIRPQSAMPDVQGFEFEK 131

  Fly   151 EERDKVNCQAAWEKFLIDFGAQ---YKNANETEKRRNVF--------------------CANWRA 192
            .|    :|:          |||   :|...|...::|.:                    ...:..
Zfish   132 ME----DCK----------GAQCEVWKTITEAGHKKNTYRLWVTRPEGNDAPATPHRFEMEGFNT 182

  Fly   193 IVE-HN----VQYEKWAEPFKRDI-NQWTDHTIEERSSPAPEIRKEEAT-----TSTSEIDNDNI 246
            ::: ||    ::|..::...:.|: ......|.||...| ||..:..|.     .||:.:.:.:.
Zfish   183 LLDSHNDKYSIEYSDFSSQTEPDVFTPPAGFTCEEFPDP-PEQHQILANPIQDYVSTNPVSHAHR 246

  Fly   247 ICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNVQFDLGNISFKKGINQWSDLTVEE 311
            :..|..||    |...|:.:.|.::|...|..:|:.::..|.:    .:||..|||:.:|.:..|
Zfish   247 MFGPFKEK----FNRQYKSEEEHQEREINFVQSFRFVNSTNRK----GLSFTVGINKRADWSRAE 303

  Fly   312 WKNKQRP 318
            .:..:.|
Zfish   304 TRKSKIP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 13/61 (21%)
Inhibitor_I29 162..221 CDD:214853 11/87 (13%)
Inhibitor_I29 252..311 CDD:214853 15/58 (26%)
Inhibitor_I29 347..406 CDD:214853
si:dkey-228a15.1XP_017207744.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.