powered by:
Protein Alignment CG6357 and ctss2.1
DIOPT Version :9
Sequence 1: | NP_610907.1 |
Gene: | CG6357 / 36532 |
FlyBaseID: | FBgn0033875 |
Length: | 439 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001019580.2 |
Gene: | ctss2.1 / 554157 |
ZFINID: | ZDB-GENE-050522-559 |
Length: | 330 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 20/74 - (27%) |
Similarity: | 35/74 - (47%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 TSGLSEFEEECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGIN 122
::.|:.|.......|:.:...:...|..:.|...||.::..|.|.:..|||:..:|:.|:...:|
Zfish 13 SAALAHFNTNLDQHWELWKKTYGKIYTTEVEEFGRRQLWERNLQLITVHNLEASMGMHSYDLSMN 77
Fly 123 QWSDLTFEE 131
...|||.||
Zfish 78 HMGDLTTEE 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
48 |
1.000 |
Domainoid score |
I11906 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12411 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.