DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctsk

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001017778.1 Gene:ctsk / 550475 ZFINID:ZDB-GENE-001205-4 Length:333 Species:Danio rerio


Alignment Length:105 Identity:32/105 - (30%)
Similarity:54/105 - (51%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 DDNTCQAAWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLT 403
            |:.:...||:.:.|....:|....|...||||:..|...|:.||:::|||:.::..|:|.:.|:|
Zfish    22 DNLSLDEAWESWKITHKREYNGLNEESIRRTIWEKNMLFIEAHNKEYELGIHTYDLGMNHFGDMT 86

  Fly   404 VEEWKTK----QRP---NLAPEFSKEETTTKISKEKKYKK 436
            :||...|    |.|   :.|..|..::...|:.|...|:|
Zfish    87 LEEVAEKVMGLQMPMYRDPANTFVPDDRVGKLPKSIDYRK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 19/58 (33%)
ctskNP_001017778.1 Inhibitor_I29 30..89 CDD:214853 19/58 (33%)
Peptidase_C1 118..332 CDD:425470 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.