DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and zgc:110239

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001017633.2 Gene:zgc:110239 / 550326 ZFINID:ZDB-GENE-050417-107 Length:546 Species:Danio rerio


Alignment Length:405 Identity:72/405 - (17%)
Similarity:129/405 - (31%) Gaps:128/405 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YLMGVALGVPVSTSSPATQKINPEIGVTTGKSDADSSTPTIEHTSGL-----SEFEEECQFAWQR 74
            :|.|..| :..:.::|..::..||.|.|             .|..||     :|.:|        
Zfish     4 FLAGFVL-LCAADATPVAERTVPEFGKT-------------YHVKGLLSLPYAEIKE-------- 46

  Fly    75 FLVDFDVHYD-------NDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTFEEW 132
               .|:..||       .||...:....|..|   ..|:...|.:..|:.:...|..........
Zfish    47 ---PFEAWYDLTGKRSRIDYYHGQVCTFFIGN---DLDYGAVYKITPVTTETEFNTMKCFQLNGT 105

  Fly   133 KEKQTPKVMPEIA-SESSKEERDKVN------CQAAWEKFLIDFGAQYKNANETEKRRNVFCANW 190
            |::   .::|:|| .:....|.:|:.      |:.            :||......::|.: ..|
Zfish   106 KDE---PIIPQIALPDVQGFEFEKIEYYAGVLCEV------------WKNVTTVGHKKNTY-RLW 154

  Fly   191 --------RAIVEHNVQ-----------YEKWAEPFKRDINQWTDHTIEERSS-------PAPEI 229
                    .:.:.|:.:           |:|:...:. |.:...|..|.:...       |.|.:
Zfish   155 VTRPEGIDSSAMPHHYEMMGFNTLLGSHYDKYIVDYS-DFSSQVDPNIFKLPGGMSCGGFPGPGV 218

  Fly   230 RKE------EATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKSIHKHNV 288
            ...      :....||.:.:.:.:.....||    |...|.::.|.|:|.:.|..|.:.:|..| 
Zfish   219 EHHLLANPIQDFVETSPVSHAHRMFGHYKEK----FNRQYDNEMEHEEREHNFVHNIRYVHSMN- 278

  Fly   289 QFDLGNISFKKGINQWSDLTVEEWK------------NKQRPAFNPEFSKVEATTKISKDKR--- 338
               ...:||...:|..:|.:.:|..            .|.:| |..|...:  .|..|.|.|   
Zfish   279 ---RAGLSFSLSVNHLADRSQKELSMMRGCQRTHKVHRKAQP-FPSEIRSI--ATPNSVDWRLYG 337

  Fly   339 ------DDNTCQAAW 347
                  |...|.:.|
Zfish   338 AVTPVKDQAVCGSCW 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 11/66 (17%)
Inhibitor_I29 162..221 CDD:214853 10/77 (13%)
Inhibitor_I29 252..311 CDD:214853 15/58 (26%)
Inhibitor_I29 347..406 CDD:214853 1/1 (100%)
zgc:110239NP_001017633.2 Inhibitor_I29 243..298 CDD:214853 15/62 (24%)
Peptidase_C1A 328..543 CDD:239068 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.