DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctsz

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:138 Identity:26/138 - (18%)
Similarity:40/138 - (28%) Gaps:44/138 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DIFCENWQKVRDHNLK--------YDLGVVSFKKGINQWSDLTFEEWKEKQTPKVMPEIASESSK 150
            |..|.|:| .:|.:.|        ...||.:..|....|                  ::....|.
Zfish   143 DETCNNYQ-AKDQDCKPFNQCGTCTTFGVCNIVKNFTLW------------------KVGDYGSA 188

  Fly   151 EERDKVNCQ-----------AAWEKFLIDFGAQYKN-ANETEKRRNVFCANWRAIVEHNVQY--- 200
            ...||:..:           .|.:|.....|..|.. ..|......|..|.| .:.|:.|::   
Zfish   189 SGLDKMKAEIYSGGPISCGIMATDKLDAYTGGLYSEYVQEPYINHIVSVAGW-GVDENGVEFWVV 252

  Fly   201 -EKWAEPF 207
             ..|.||:
Zfish   253 RNSWGEPW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 10/45 (22%)
Inhibitor_I29 162..221 CDD:214853 12/51 (24%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.