DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctsl.1

DIOPT Version :10

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001002368.1 Gene:ctsl.1 / 436641 ZFINID:ZDB-GENE-040718-61 Length:334 Species:Danio rerio


Alignment Length:63 Identity:18/63 - (28%)
Similarity:36/63 - (57%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 AWKKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFKKGINQWSDLTVEEWK 408
            |||   :.||..|:..:|...|:..:..|.|.:..||...:.|::|::.|:..::|::.||::
Zfish    28 AWK---LKFGKSYRSAEEESHRQLTWLTNRKLVLVHNMMADQGLKSYRLGMTYFADMSNEEYR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853 15/58 (26%)
ctsl.1NP_001002368.1 Inhibitor_I29 26..86 CDD:462410 17/60 (28%)
Peptidase_C1 118..333 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.