DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and Ctsql2

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001002813.2 Gene:Ctsql2 / 408201 RGDID:1303225 Length:343 Species:Rattus norvegicus


Alignment Length:166 Identity:38/166 - (22%)
Similarity:67/166 - (40%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SGLSEFEEECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQ 123
            ||.|.|.......||.:.:.::..|..:.|..| |.::.||.:|:..||.:..||..::...||.
  Rat    16 SGASAFNLSLDVQWQEWKMKYEKLYSPEEELLK-RVVWEENVKKIELHNRENSLGKNTYIMEINN 79

  Fly   124 WSDLTFEEWKEKQTPKVMPEIASESSKEERDKVN--CQAAWEKFLIDFGAQYKNANETEKRRNVF 186
            ::|||.||:|:..|...:|             :|  .::.|::.|   |:.:.|:          
  Rat    80 FADLTDEEFKDMITGITLP-------------INNTMKSLWKRAL---GSPFPNS---------- 118

  Fly   187 CANWRAIVEHNVQYEK----------------WAEP 206
             ..||..:..::.:.|                ||.|
  Rat   119 -WYWRDALPKSIDWRKEGYVTRVREQGKCKSCWAFP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 19/59 (32%)
Inhibitor_I29 162..221 CDD:214853 10/61 (16%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
Ctsql2NP_001002813.2 Inhibitor_I29 29..87 CDD:214853 18/58 (31%)
Peptidase_C1 125..342 CDD:278538 4/29 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.