DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and ctsba

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_998501.1 Gene:ctsba / 406645 ZFINID:ZDB-GENE-040426-2650 Length:330 Species:Danio rerio


Alignment Length:329 Identity:56/329 - (17%)
Similarity:83/329 - (25%) Gaps:163/329 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLIDFGAQYKNANETEKRRNVFCANWRAIV 194
            |:|....|           .||.||:.:|.:.|.     |||.     |....|....::.:..|
Zfish    87 EQWPNCPT-----------LKEIRDQGSCGSCWA-----FGAA-----EAISDRVCIHSDAKVSV 130

  Fly   195 EHNVQ---------------------YEKWA---------------------EPFKRDINQWTDH 217
            |.:.|                     ::.||                     ||.:..:|     
Zfish   131 EISSQDLLTCCDSCGMGCNGGYPSAAWDFWATEGLVTGGLYNSHIGCRPYTIEPCEHHVN----- 190

  Fly   218 TIEERSSPAPEIRKEEATTSTSEIDNDNIICQPAWEKFLIDFKPSYQDDTETEKRRNVFCDNFKS 282
                  ...|....|...|     .|.::.|:|.       :.|||:.|                
Zfish   191 ------GSRPPCSGEGGDT-----PNCDMKCEPG-------YSPSYKQD---------------- 221

  Fly   283 IHKHNVQFDLGNISFKKGINQWSDLTVEEWKNKQRPAFNPEFSKVEATTKISKDKRDDNTCQAAW 347
              ||     .|..|:....|| :.:..|.:||          ..||....:.:|           
Zfish   222 --KH-----FGKTSYSVPSNQ-NSIMAELFKN----------GPVEGAFTVYED----------- 257

  Fly   348 KKFLIDFGAKYQDEKETEKRRTIFCDNWKAIQEHNEQFELGVESFK-------KGINQWSDLTVE 405
              ||:.....||                     |.....:|..:.|       .|:..|  |...
Zfish   258 --FLLYKSGVYQ---------------------HMSGSPVGGHAIKILGWGEENGVPYW--LAAN 297

  Fly   406 EWKT 409
            .|.|
Zfish   298 SWNT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 1/1 (100%)
Inhibitor_I29 162..221 CDD:214853 14/100 (14%)
Inhibitor_I29 252..311 CDD:214853 10/58 (17%)
Inhibitor_I29 347..406 CDD:214853 10/65 (15%)
ctsbaNP_998501.1 Propeptide_C1 25..64 CDD:285358
Peptidase_C1A_CathepsinB 80..327 CDD:239111 56/329 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.