DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6357 and cer

DIOPT Version :9

Sequence 1:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster


Alignment Length:78 Identity:27/78 - (34%)
Similarity:47/78 - (60%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EEECQFAWQRFLVDFDVHYDNDYERQKRRDIFCENWQKVRDHNLKYDLGVVSFKKGINQWSDLTF 129
            :||    |..:...||.:|:.:.:..:|| |:.|:..::.:||.|::.|.|::|.|||..:|||.
  Fly     6 DEE----WVEYKSKFDKNYEAEEDLMRRR-IYAESKARIEEHNRKFEKGEVTWKMGINHLADLTP 65

  Fly   130 EEWKEKQTPKVMP 142
            ||:.::...||.|
  Fly    66 EEFAQRCGKKVPP 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:285458 21/59 (36%)
Inhibitor_I29 162..221 CDD:214853
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009916
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.